IEDB Analysis Resource

RESTful interface (IEDB-API):

Several IEDB Analysis tools can now be accessed via the RESTful (REpresentational State Transfer) Web Services. This service is currently available for MHC-I and MHC-II binding, MHC-I processing and MHC-NP predictions for T-cell epitopes. The service sends POST request to the tools server, and relies on user supplied parameters. Below are some examples for accessing the service using the 'curl' program. Note that any program that sends POST requests to the server will work just as well (including a web browser).
The full list of parameters and their values for MHC I and MHC II-binding, MHC I-processing and MHC-NP predictions are given in the table below. Please use these services instead of screen-scraping.
In release 2.15, a new API system for the class I binding predictions was made public. For end users, it should result in faster prediction times over the previous iterations, especially for large batches of sequences and CPU-intensive methods such as NetMHCPan and PickPocket.
* If relevant services are missing, please contact us.

Examples for Class-I binding prediction
1) To run a single allele and length combination:
$ curl --data "method=smm&sequence_text=SLYNTVATLYCVHQRIDV&allele=HLA-A*01:01&length=9"

2) To run multiple allele and length combinations:
$ curl --data "method=recommended&sequence_text=SLYNTVATLYCVHQRIDV&allele=HLA-A*01:01,HLA-A*02:01&length=8,9"

3) To submit multiple sequences at a time, escape the special characters in a fasta-formatted sequence with URI codes.
E.g., we can predict for 2 sequences (with fasta names peptide1 and peptide2) with the following code:
$ curl --data "method=ann&sequence_text=%3Epeptide1%0AGHAHKVPRRLLKAAR%0A%3Epeptide2%0ALKAADASADADGSGSGSGSG&allele=HLA-A*01:01,HLA-A*03:01&length=9,10"

MHC-I binding command line parameters:
Parameter Possible values Default value Required Description
sequence_text * Input protein sequence.
method recommended, consensus, netmhcpan, ann, smmpmbec, smm, comblib_sidney2008, netmhccons, pickpocket, netmhcstabpan recommended This allows selection from 8 different MHC class I binding prediction methods. 'recommended' method considers, for each allele-length combination, 'consensus' method (which includes ann, smm and comblib) first, and if not available, it uses 'netmhcpan'.

To print the usage and list all available methods:
$ curl --data ""
allele Allele name * A comma-separated list of the alleles for which to make predictions. This list gets paired with the length list, so there must be a corresponding length for each allele.

To list all available alleles for a specific method and species:
$ curl --data "method=ann&species=human"
length 8, 9, 10, 11, 12, 13, 14, 15 * A comma-separated list of the lengths for which to make predictions. This list gets paired with the allele list, so there must be a corresponding allele for each length.

Examples for Class-II binding prediction
1) To run a single allele:
$ curl --data "method=nn_align&sequence_text=SLYNTVATLYCVHQRIDV&allele=HLA-DRB1*01:01"

2) To run multiple alleles:
$ curl --data "method=recommended&sequence_text=SLYNTVATLYCVHQRIDV&allele=HLA-DRB1*01:01,H2-IAb"

3) Select allele(s) with α and β chains:
The two chains must be separated by '/' character as in the example below:
$ curl --data "method=recommended&sequence_text=SLYNTVATLYCVHQRIDV&allele=DPA1*01/DPB1*04:01"

4) To submit multiple sequences at a time, escape the special characters in a fasta-formatted sequence with URI codes.
E.g., we can predict for 2 sequences (with fasta names peptide1 and peptide2) with the following code:
$ curl --data "method=recommended&sequence_text=%3Epeptide1%0AGHAHKVPRRLLKAAR%0A%3Epeptide2%0ALKAADASADADGSGSGSGSG&allele=HLA-DRB1*01:01,HLA-DRB1*03:01"

MHC-II binding command line parameters:
Parameter Possible values Default value Required Description
sequence_text * Input protein sequence.
method recommended, consensus, NetMHCIIpan, nn_align, smm_align, comblib, tepitope recommended This allows selection from 8 different MHC class II binding prediction methods. 'recommended' method considers, for each allele-length combination, 'consensus' method (which includes comblib, smm and nn) first, and if not available, it uses 'NetMHCIIpan'.

To print the usage and list all available methods:
$ curl --data ""
allele Allele name * A comma-separated list of the alleles for which to make predictions.

To list all available alleles for a specific method:
$ curl --data "method=nn_align"

Examples for MHC-I Processing prediction
1) To run a single allele and length combination:
$ curl --data "method=smm&sequence_text=SLYNTVATLYCVHQRIDV&allele=HLA-A*01:01&length=9"

2) To run multiple allele and length combinations:
$ curl --data "method=recommended&sequence_text=SLYNTVATLYCVHQRIDV&allele=HLA-A*01:01,HLA-A*02:01&length=8,9"

3) To submit multiple sequences at a time, escape the special characters in a fasta-formatted sequence with URI codes.
E.g., we can predict for 2 sequences (with fasta names peptide1 and peptide2) with the following code:
$ curl --data "method=ann&sequence_text=%3Epeptide1%0AGHAHKVPRRLLKAAR%0A%3Epeptide2%0ALKAADASADADGSGSGSGSG&allele=HLA-A*01:01,HLA-A*03:01&length=9,10"

MHC-I processing command line parameters:
Parameter Possible values Default value Required Description
sequence_text * Input protein sequence.
method recommended, consensus, netmhcpan, ann, smmpmbec, smm, comblib_sidney2008 recommended This allows selection from 8 different MHC class I binding prediction methods. 'recommended' method considers, for each allele-length combination, 'consensus' method (which includes ann, smm and comblib) first, and if not available, it uses 'netmhcpan'.

To print the usage and list all available methods:
$ curl --data ""
allele Allele name * A comma-separated list of the alleles for which to make predictions. This list gets paired with the length list, so there must be a corresponding length for each allele.

To list all available alleles for a specific method and species:
$ curl --data "method=ann&species=human"
length 8, 9, 10, 11, 12, 13, 14 * A comma-separated list of the lengths for which to make predictions. This list gets paired with the allele list, so there must be a corresponding allele for each length.
proteasome immuno, constitutive immuno There are two types of proteasomes, the constitutively expressed 'house-keeping' type, and immuno proteasomes that are induced by IFN-γ secretion.

Examples for MHC-NP prediction
1) To run a single allele and length combination:
$ curl --data "method=mhcnp&sequence_text=SLYNTVATLYCVHQRIDV&allele=HLA-A*02:01&length=9"

2) To run multiple allele and length combinations:
$ curl --data "method=mhcnp&sequence_text=SLYNTVATLYCVHQRIDV&allele=HLA-A*02:01,H-2-Db&length=8,9"

3) To submit multiple sequences at a time, escape the special characters in a fasta-formatted sequence with URI codes.
E.g., we can predict for 2 sequences (with fasta names peptide1 and peptide2) with the following code:
$ curl --data "method=mhcnp&sequence_text=%3Epeptide1%0AGHAHKVPRRLLKAAR%0A%3Epeptide2%0ALKAADASADADGSGSGSGSG&allele=HLA-A*02:01,H-2-Db&length=8,9"

MHC-NP command line parameters:
Parameter Possible values Default value Required Description
sequence_text * Input protein sequence.
method mhcnp mhcnp This allows just one prediction method - 'mhcnp' method.

To print the usage:
$ curl --data ""
allele Allele name * A comma-separated list of the alleles for which to make predictions. This list gets paired with the length list, so there must be a corresponding length for each allele. Currently, the tool supports only HLA-A*02:01, HLA-B*07:02, HLA-B*35:01, HLA-B*44:03, HLA-B*53:01, HLA-B*57:01, H-2-Db, and H-2-Kb alleles

To list all available alleles for a specific method:
$ curl --data "method=mhcnp"
length 8, 9, 10, 11 * A comma-separated list of the lengths for which to make predictions. This list gets paired with the allele list, so there must be a corresponding allele for each length.

Examples for Antibody Epitope Prediction
1) To run the prediction for a sequence:

2) To run the prediction for a sequence using window_size option:
$ curl --data "method=Emini&sequence_text=VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTE&window_size=9"

Antibody Epitope Prediction command line parameters:
Parameter Possible values Default value Required Description
sequence_text * Input protein sequence.
method Chou-Fasman, Emini, Karplus-Schulz, Kolaskar-Tongaonkar, Parker, Bepipred Bepipred This allows selection from 6 different Antibody Epitope prediction methods.
window_size An integer value

IEDB       Help       Contact

This site is best viewed with current versions of Mozilla Firefox or Google Chrome.